Protein Info for Psest_3516 in Pseudomonas stutzeri RCH2

Updated annotation (from data): Leucine dehydrogenase (EC 1.4.1.9)
Rationale: Specifically important for utilizing L-Leucine. Automated validation from mutant phenotype: the predicted function (1.4.1.9) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: Glutamate dehydrogenase/leucine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF02812: ELFV_dehydrog_N" amino acids 12 to 131 (120 residues), 98 bits, see alignment E=3.7e-32 PF00208: ELFV_dehydrog" amino acids 221 to 300 (80 residues), 30.9 bits, see alignment E=2.4e-11

Best Hits

Swiss-Prot: 48% identical to DHLE_BACSU: Leucine dehydrogenase (yqiT) from Bacillus subtilis (strain 168)

KEGG orthology group: K00263, leucine dehydrogenase [EC: 1.4.1.9] (inferred from 92% identity to psa:PST_0867)

Predicted SEED Role

"Leucine dehydrogenase (EC 1.4.1.9)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Degradation and HMG-CoA Metabolism (EC 1.4.1.9)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRL8 at UniProt or InterPro

Protein Sequence (364 amino acids)

>Psest_3516 Leucine dehydrogenase (EC 1.4.1.9) (Pseudomonas stutzeri RCH2)
MSVFAHPDFDRHEQVVFCHDQASGLKAIIAIHDTRLGPALGGCRMFPYANDDDALRDVLR
LSRGMTLKSSLAGLKLGGGKAVIIGDPHTGKSQTLLHAMGDFVDSLGGRYITAADSGTGD
AEMQAFAQRTRHVVGATPRTTLDGSIASGDPSPSTAYGVFVGLKEAVRQRLGRDDLAGLK
VAIQGVGHVGLGLARHLKAAGAELWVADIFDANVKQAMEEVGANVVRPQDIYGLDVDVFA
PCAMGGILNEQTLEVLRAPVIAGAANNQLATAEIGIELQRRNQLYAPDYAINAGGIIDVY
YQRTGGSAAQIDAHVKAIGDTLGEIFTRSAASGEPTSVIADRLALERLHAGGVPQTEAFK
RQAS