Protein Info for PGA1_c35040 in Phaeobacter inhibens DSM 17395

Annotation: nucleoside-triphosphatase RdgB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00042: non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
  • amino acids 10 to 200 (191 residues), 157.8 bits, E=9.6e-51
• PF01725: Ham1p_like
  • amino acids 10 to 199 (190 residues), 202 bits, E=4.3e-64

Best Hits

Swiss-Prot: 84% identical to IXTPA_RUEPO: dITP/XTP pyrophosphatase (SPO0007) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K01516, nucleoside-triphosphatase [EC: 3.6.1.15] (inferred from 84% identity to sil:SPO0007)

Predicted SEED Role

"Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15)" in subsystem Heat shock dnaK gene cluster extended (EC 3.6.1.15)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.15

Sequence Analysis Tools

See I7F3W9 at UniProt or InterPro

Protein Sequence (204 amino acids)

>PGA1_c35040 nucleoside-triphosphatase RdgB (Phaeobacter inhibens DSM 17395)
MTRKFVGDRLLVATHNKGKLEEMKHLLQPFGVTVVGAGEMDLPEPAETEDTFVGNARIKA
HAAAKATGLPALSDDSGITIDALDGAPGVYTADWAETGDGRDFMMAMTRAHNELEAKGAA
HPRLAQFRCTLVLAWPDGHDEVFEGVMPGQLVWPIRGKDGFGYDPMFQPDGHTQTCAEMD
RWAKNKISHRGQAVAKFVEACFGG