Protein Info for PGA1_c35040 in Phaeobacter inhibens DSM 17395
Annotation: nucleoside-triphosphatase RdgB
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 84% identical to IXTPA_RUEPO: dITP/XTP pyrophosphatase (SPO0007) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
KEGG orthology group: K01516, nucleoside-triphosphatase [EC: 3.6.1.15] (inferred from 84% identity to sil:SPO0007)Predicted SEED Role
"Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15)" in subsystem Heat shock dnaK gene cluster extended (EC 3.6.1.15)
MetaCyc Pathways
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
- pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
- UTP and CTP dephosphorylation I (5/7 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.6.1.15
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I7F3W9 at UniProt or InterPro
Protein Sequence (204 amino acids)
>PGA1_c35040 nucleoside-triphosphatase RdgB (Phaeobacter inhibens DSM 17395) MTRKFVGDRLLVATHNKGKLEEMKHLLQPFGVTVVGAGEMDLPEPAETEDTFVGNARIKA HAAAKATGLPALSDDSGITIDALDGAPGVYTADWAETGDGRDFMMAMTRAHNELEAKGAA HPRLAQFRCTLVLAWPDGHDEVFEGVMPGQLVWPIRGKDGFGYDPMFQPDGHTQTCAEMD RWAKNKISHRGQAVAKFVEACFGG