Protein Info for Psest_3515 in Pseudomonas stutzeri RCH2

Annotation: Na+-dependent transporters of the SNF family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 32 to 49 (18 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 112 to 137 (26 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details amino acids 236 to 264 (29 residues), see Phobius details amino acids 276 to 298 (23 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details amino acids 367 to 389 (23 residues), see Phobius details amino acids 409 to 426 (18 residues), see Phobius details amino acids 447 to 467 (21 residues), see Phobius details PF00209: SNF" amino acids 25 to 144 (120 residues), 86.9 bits, see alignment E=6.6e-29 amino acids 174 to 462 (289 residues), 77.5 bits, see alignment E=4.9e-26

Best Hits

KEGG orthology group: K03308, neurotransmitter:Na+ symporter, NSS family (inferred from 98% identity to psa:PST_0868)

Predicted SEED Role

"Sodium-dependent transporter family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRS8 at UniProt or InterPro

Protein Sequence (469 amino acids)

>Psest_3515 Na+-dependent transporters of the SNF family (Pseudomonas stutzeri RCH2)
MSDKTSLAAGTFAGARARIQDNASRGLWSSRWVFFLAATGSAVGLGNIWKFPYVTGQNGG
GAFVLVYLACILLIGIPLLMTEVMIGRRGRANPDGAVARLAREAGASSRWRVVGWLGGLT
GFLILSFYLVVAGWALAYVPATFSGGFAGVSGEASGELFGALLADPLRLVVCATLVLAAT
MLIVGFGVRGGLERSLRFLMPGLFVLMLVLVVYAAIEGEFAQALQFLFVPDFSALTAQSV
LIALGHAFFTLSLGCGAMMVYGSYLPEGTSIAKTSILVALADTAVALLAGLAIFPLVFGN
GLEPGAGPGLIFVTLPIAFGQMPLGQVVGGLFFIMLVIAALTSAISLSEPSIAWLTERFR
ISRTKAVLGSGLVLWLLSLGSVFSFNHWADYQLFGKTFFDTLDYLTTNWLMPLGGLGTVL
FTGWVLQRQVVSEAIGIRNAGLFQAWWNLLRYGTPVAIVLVFLNLLGLI