Protein Info for Psest_0346 in Pseudomonas stutzeri RCH2

Updated annotation (from data): small component of pyruvate/D-alanine transporter (TIGR03647)
Rationale: Important for utilization of D-alanine and pyruvate, along with Psest_0347. Belongs to TIGR03647, which was predicted to be the small subunit of a transporter.
Original annotation: putative solute:sodium symporter small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 87 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details PF13937: DUF4212" amino acids 10 to 86 (77 residues), 107.7 bits, see alignment E=1.6e-35 TIGR03647: putative solute:sodium symporter small subunit" amino acids 11 to 87 (77 residues), 102.2 bits, see alignment E=7e-34

Best Hits

KEGG orthology group: None (inferred from 82% identity to pmk:MDS_4422)

Predicted SEED Role

"FIG152265: Sodium:solute symporter associated protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGS5 at UniProt or InterPro

Protein Sequence (87 amino acids)

>Psest_0346 small component of pyruvate/D-alanine transporter (TIGR03647) (Pseudomonas stutzeri RCH2)
MADNDKENAAAYWKANVRLITWSLVVWALVSYGFGILLRPLVAGIPVGGTDLGFWFAQQG
SIITFIAIIFHYAWRLNKLDKEFGVEE