Protein Info for Psest_3514 in Pseudomonas stutzeri RCH2

Updated annotation (from data): 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)
Rationale: Specifically important for utilizing L-tyrosine disodium salt. Automated validation from mutant phenotype: the predicted function (4-HYDROXYPHENYLPYRUVATE-DIOXYGENASE-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: 4-hydroxyphenylpyruvate dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF14696: Glyoxalase_5" amino acids 10 to 149 (140 residues), 177.7 bits, see alignment E=2.7e-56 TIGR01263: 4-hydroxyphenylpyruvate dioxygenase" amino acids 17 to 356 (340 residues), 412.8 bits, see alignment E=7.9e-128 PF00903: Glyoxalase" amino acids 166 to 277 (112 residues), 49.3 bits, see alignment E=1.3e-16 PF13669: Glyoxalase_4" amino acids 214 to 283 (70 residues), 29.6 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 90% identical to HPPD_PSEAE: 4-hydroxyphenylpyruvate dioxygenase (hpd) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00457, 4-hydroxyphenylpyruvate dioxygenase [EC: 1.13.11.27] (inferred from 97% identity to psa:PST_0869)

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.27

Use Curated BLAST to search for 1.13.11.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMQ0 at UniProt or InterPro

Protein Sequence (361 amino acids)

>Psest_3514 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) (Pseudomonas stutzeri RCH2)
MNAVNKIEQHNPIGTDGFEFVEFTAPNAEGIEQLRTLFTQMGFTETAKHRSKEVWLFQQH
DINIVLNGSPTGHVHAFAEKHGPSACAMAFRVKNAAQAAAYVESQGAKLVGSHANFGELN
IPCVEGIGGSLLYLVDRYGDKSIYDVDFEYIEGRTPNDNAVGLMCIDHLTHNVMRGQMDV
WSGFYERIANFREIRYFDIEGKLTGLFSRAMTAPCGKIRIPINESADDKSQIEEFIREYH
GEGIQHIALSTDDIYATVRQLRANGVDFMTTPDTYYEKVDTRVAGHGEPTDVLRELNILI
DGAPGDDGILLQIFTNTVIGPIFFEIIQRKGNQGFGEGNFKALFESIEEDQLRRGVIKAD
E