Protein Info for Psest_3512 in Pseudomonas stutzeri RCH2

Updated annotation (from data): fumarylacetoacetate (FAA) hydrolase (EC 3.7.1.2)
Rationale: Specifically important for: L-tyrosine disodium salt; casamino acids. The annotation of psa:PST_0871 has been updated to fumarylacetoacetate (FAA) hydrolase [EC:3.7.1.2], which is a step in tyrosine catabolism (KEGG_correct)
Original annotation: 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF18288: FAA_hydro_N_2" amino acids 1 to 77 (77 residues), 95.6 bits, see alignment E=2e-31 PF01557: FAA_hydrolase" amino acids 80 to 322 (243 residues), 127.7 bits, see alignment E=5.2e-41

Best Hits

KEGG orthology group: None (inferred from 99% identity to psa:PST_0871)

Predicted SEED Role

"Fumarylacetoacetate hydrolase family protein" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPV2 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Psest_3512 fumarylacetoacetate (FAA) hydrolase (EC 3.7.1.2) (Pseudomonas stutzeri RCH2)
MKLATLNQGRDGVLVVVSRDLAQAVKVPQIAATLQAALDDWNYCKPKLEAVYQRLNDGLE
EGAFAFDQTACHSPLPRAYHWADGSAYVNHVELVRKARGAEMPESFWHDPLMYQGGADAF
IPPHSPIRLADEAWGIDLEGELAVITDDVPMGATPAEAASHIQLLMLVNDVSLRNLIPGE
LAKGFGFYQSKPSSSFSPVAVTPDELGETWRDGKVHRPLVSHINGELFGQPDAGTDMTFN
FPTLVAHAARTRPLGAGTIIGSGTVSNYDRSAGSSCLAEKRMLEVVEHGEAKTPFLKFGD
RVRIEMFDAAGQSIFGAIDQQVERYGH