Protein Info for Psest_3510 in Pseudomonas stutzeri RCH2

Annotation: Na+-dependent transporters of the SNF family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 94 to 119 (26 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 222 to 246 (25 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 306 to 333 (28 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 391 to 408 (18 residues), see Phobius details amino acids 426 to 452 (27 residues), see Phobius details amino acids 458 to 476 (19 residues), see Phobius details PF00209: SNF" amino acids 9 to 132 (124 residues), 89 bits, see alignment E=1.6e-29 amino acids 154 to 447 (294 residues), 92 bits, see alignment E=2e-30

Best Hits

KEGG orthology group: None (inferred from 98% identity to psa:PST_0873)

Predicted SEED Role

"Sodium-dependent transporter family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRS2 at UniProt or InterPro

Protein Sequence (486 amino acids)

>Psest_3510 Na+-dependent transporters of the SNF family (Pseudomonas stutzeri RCH2)
MTREKPKNLWLSRWGFILAATGSAVGLGNIWKFPYITGEFGGGAFVLMYLLCILAIGVPV
MMCEIAIGRRGRGSPIDAIGRVVRENNGNPLWKAVGGMAMTAGFLILCFYVVVAGWAFAY
TVKMLDGSLAATSVEALGGVFEAHNSNPWQLGGWSLLVALLTLWIVAKGVQKGIENAVRW
MMPGLAVLLLILVGYAVTSGGFDQGFAFLFSFDTSKITGEALLAALGHAFFTLSLASGAI
LTYGSYIPDDQSIARTTFMVAIADTCVALLAGLAIFPIIFANGMDPTAGPGLIFMSLPLA
FQQMPFGTAFGVLFFAMVSIAALTSAISMIEATVAYLNEKHGISRLKAAMGSGAVLLVIS
MLAMLSFNLMSGWTPMGKNFFDWLDYLTSRWMMPLGGIFTVLLAGYALRSEIMRDELNLP
PLGYALWLFMVRYVCPVLILMVFLHALGWLGFDPLQRWYWIAGAIGALTLVGELLRPRVM
PALAGR