Protein Info for HP15_3384 in Marinobacter adhaerens HP15

Annotation: HIT (histidine triad) family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 PF11969: DcpS_C" amino acids 4 to 105 (102 residues), 100.3 bits, see alignment E=9.5e-33 PF01230: HIT" amino acids 11 to 107 (97 residues), 102.4 bits, see alignment E=1.8e-33

Best Hits

Swiss-Prot: 56% identical to HINT_HAEIN: Purine nucleoside phosphoramidase (HI_0961) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 89% identity to maq:Maqu_3623)

MetaCyc: 56% identical to purine nucleoside phosphoramidase (Escherichia coli K-12 substr. MG1655)
3.9.1.-

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (EC 3.6.1.17)" (EC 3.6.1.17)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRQ1 at UniProt or InterPro

Protein Sequence (121 amino acids)

>HP15_3384 HIT (histidine triad) family protein (Marinobacter adhaerens HP15)
MSETIFTKIINREIPADILYEDDIALAFSDINPQAPVHFLVIPKKAIATINDITEEDREL
VGHLYLVAAKIAQEKGFADDGYRVVMNCGENSGQTVFHIHLHVLAGKPLGWPPYTDKMKQ
A