Protein Info for HP15_3381 in Marinobacter adhaerens HP15

Annotation: MscS mechanosensitive ion channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 64 to 87 (24 residues), see Phobius details amino acids 92 to 122 (31 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 16 to 44 (29 residues), 22.1 bits, see alignment (E = 1.7e-08) PF00924: MS_channel_2nd" amino acids 110 to 175 (66 residues), 69 bits, see alignment E=4.7e-23 PF21082: MS_channel_3rd" amino acids 184 to 264 (81 residues), 66.5 bits, see alignment E=3.5e-22

Best Hits

Swiss-Prot: 34% identical to MSCS_WIGBR: Small-conductance mechanosensitive channel (mscS) from Wigglesworthia glossinidia brevipalpis

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 90% identity to maq:Maqu_3620)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRP8 at UniProt or InterPro

Protein Sequence (277 amino acids)

>HP15_3381 MscS mechanosensitive ion channel (Marinobacter adhaerens HP15)
MEDLFGAEGGASELMNQAMSLVMTYAPKVVLAIVTLIVGMWLINRFVGVLDNKLGKKDPT
LNKFLCGLIGAILKILLLISVASMVGIATTSFIAIIGAAGLAVGLALQGSLANFAGGVLI
LIFKPFKVGDTIDAQGYLGSVREISILYTIVDTFDNRRIVIPNGQLANASLTNLSAYETR
RCDMSFGIGYGDDIDKAKAVCKRLIEEDERALKDPEPLIVVGALGESSVDLTVRAWTKSG
DLWPFYWDMHEKVKKAFDAEGISIPFPQRDVHMIKTD