Protein Info for Psest_3502 in Pseudomonas stutzeri RCH2

Annotation: flavoprotein, HI0933 family/uncharacterized flavoprotein, PP_4765 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 PF01494: FAD_binding_3" amino acids 8 to 37 (30 residues), 26.5 bits, see alignment (E = 1.2e-09) PF07992: Pyr_redox_2" amino acids 8 to 180 (173 residues), 27 bits, see alignment E=9.1e-10 PF03486: HI0933_like" amino acids 9 to 401 (393 residues), 250.1 bits, see alignment E=6.9e-78 TIGR00275: flavoprotein, HI0933 family" amino acids 10 to 400 (391 residues), 288.2 bits, see alignment E=9.2e-90 PF13450: NAD_binding_8" amino acids 12 to 43 (32 residues), 23.6 bits, see alignment (E = 1.6e-08) TIGR03862: flavoprotein, TIGR03862 family" amino acids 30 to 407 (378 residues), 538.7 bits, see alignment E=6.5e-166 PF22780: HI0933_like_1st" amino acids 196 to 349 (154 residues), 101.6 bits, see alignment E=1.3e-32

Best Hits

KEGG orthology group: K07007, (no description) (inferred from 93% identity to psa:PST_0881)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPU2 at UniProt or InterPro

Protein Sequence (410 amino acids)

>Psest_3502 flavoprotein, HI0933 family/uncharacterized flavoprotein, PP_4765 family (Pseudomonas stutzeri RCH2)
MTPPAPSYRVAIIGGGPAGLMAAEVLGQAGVTVDLYDAMPSVGRKFLLAGVGGMNITHAE
DYAAFVNRYGERAGELRPLLDAFTPAALREWIHGLGIDTFVGSSGRVFPSDMKAAPLLRA
WLKRLRESGVQLHTRQRWLGWDEHGALRIAGPQGETRVAAHATLLALGGGSWARLGSDGA
WVRLLQNRGIAIAPLQPANCGFEVAGWSEHLREKFAGAPLKTVSLALPGEAPRKGEFVLT
ATGIEGSLVYALSARIRETINRDGAATVLLDLLPDRSQVQIADALARPRGSQSMAKHLHR
QLKLDGVKAALLRELTDATTFHDPQALAAAIKALPIRLLHPRPLDEAISSAGGVPFEALD
ANLMLRQLPGVFCAGEMLDWEAPTGGYLLTACFASGRAAAEGMLRWLRDH