Protein Info for PGA1_c34880 in Phaeobacter inhibens DSM 17395

Annotation: putative response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 PF00072: Response_reg" amino acids 21 to 132 (112 residues), 102.5 bits, see alignment E=1.5e-33 PF07228: SpoIIE" amino acids 216 to 418 (203 residues), 130.3 bits, see alignment E=8.5e-42

Best Hits

KEGG orthology group: None (inferred from 84% identity to sit:TM1040_2887)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E5L1 at UniProt or InterPro

Protein Sequence (423 amino acids)

>PGA1_c34880 putative response regulator (Phaeobacter inhibens DSM 17395)
MLPDSSIEINQEVATNSIRRVLVVDDSRLQRRILVASLKKWGFEVVEAESGEAAMEICES
DPPDLILSDWMMPGMNGLEFCRAFRTKSQDNYSYFILLTSKSEKNEVAQGLDAGADDFLT
KPVSSDELRARISAGERILRMQRELSEKNRIVSDTLDELQRVYDAIDKDLIQARKIQESL
VPELSRDFGSSTVSLLLKPCGHIGGDLVGMFSPGVNRIGFYSVDVSGHGITSAMMTARLG
GYLSSTYFDQNVGMEKRFNRFYALRQPEEVASLLNARLIADTGIEEYFTMAYCIVDLRSG
VLKMVQAGHPHPLLIRKDGSTEFIGKGGVPVGLVPDITYSQEDVVMEKGDRLLLYSDGFT
EARLENGEMLEAEGLVELIGKCNAEQTGQEFLDDLYWNLTQVMSSQYGLEDDVSATLFEY
EGP