Protein Info for HP15_3371 in Marinobacter adhaerens HP15

Annotation: dienelactone hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF05448: AXE1" amino acids 38 to 166 (129 residues), 26.4 bits, see alignment E=8.6e-10 PF01738: DLH" amino acids 42 to 263 (222 residues), 162.8 bits, see alignment E=2.8e-51 PF00326: Peptidase_S9" amino acids 74 to 155 (82 residues), 22.9 bits, see alignment E=1.7e-08 PF02230: Abhydrolase_2" amino acids 104 to 231 (128 residues), 23.4 bits, see alignment E=1.5e-08 PF08840: BAAT_C" amino acids 120 to 169 (50 residues), 22 bits, see alignment 4.5e-08

Best Hits

KEGG orthology group: None (inferred from 84% identity to maq:Maqu_0425)

Predicted SEED Role

"Dienelactone hydrolase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRN8 at UniProt or InterPro

Protein Sequence (267 amino acids)

>HP15_3371 dienelactone hydrolase family protein (Marinobacter adhaerens HP15)
MTPLKATAAAATFSIALASTQVLAEMQTKTVEYKVGETTFTGYMAWDNEFEEKRPGVLVV
HEWWGHNDFARDQAERLAAAGYTAFALDMYGSGKQADHPDTAQKFMQEATKDMDQVKARF
MKATEILQNHESVDASRIAAQGYCFGGAVVLNMARMGVDLDGVVSYHGALGSPITAEAGT
VKARVQVYTGGADKMVPSDQVAGLVKEMQDAEVDLTLVSFPGVLHSFTNPGADKVAEEFG
MPLGYDEEAATRSWEGTMRFYEAIFAR