Protein Info for HP15_3370 in Marinobacter adhaerens HP15

Annotation: alanine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR00518: alanine dehydrogenase" amino acids 1 to 370 (370 residues), 512.7 bits, see alignment E=2.6e-158 PF05222: AlaDh_PNT_N" amino acids 4 to 137 (134 residues), 169.8 bits, see alignment E=7.3e-54 PF01262: AlaDh_PNT_C" amino acids 141 to 352 (212 residues), 288.8 bits, see alignment E=4.6e-90 PF00070: Pyr_redox" amino acids 170 to 219 (50 residues), 22.9 bits, see alignment 2e-08

Best Hits

Swiss-Prot: 64% identical to DHA_HALED: Alanine dehydrogenase (ald) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: K00259, alanine dehydrogenase [EC: 1.4.1.1] (inferred from 72% identity to pmk:MDS_0509)

MetaCyc: 55% identical to alanine dehydrogenase subunit (Klebsiella aerogenes)
Alanine dehydrogenase. [EC: 1.4.1.1]

Predicted SEED Role

"Alanine dehydrogenase (EC 1.4.1.1)" in subsystem Pyruvate Alanine Serine Interconversions (EC 1.4.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRN7 at UniProt or InterPro

Protein Sequence (372 amino acids)

>HP15_3370 alanine dehydrogenase (Marinobacter adhaerens HP15)
MRIGVPREIKNREYRVGMTPAAVHELCGHNHEVFVETGAGLAIGFSDEDYRQAGARILET
AGEVFDTAELIVKVKEPQAEERAMLKPEHTLFTYLHLAPDKAQTDDLVKSGATCIAYETV
TDHGGHLPLLAPMSEVAGRMSIQAGAHCLEKAMGGRGVLLGGVPGVSPARVAVVGGGVVG
QNAIAMAVGLSAQVTVLDRNMDVLRNLDHLYGNRITTLFSTAQTLDQAVTESDLVIGSVL
IPGASAPKLITRDMIRRMPEGSVIVDVAIDQGGCAETSRATTHDDPTYIVDGVVHYCVAN
MPGAVARTSTLALNNVTLPFVAALANKGPDRAMKEDQHLRAGLNVAAGKVTYREVAEATG
HPYTNPESLLGS