Protein Info for HP15_3369 in Marinobacter adhaerens HP15

Annotation: glutathione S-transferase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13417: GST_N_3
  • amino acids 3 to 73 (71 residues), 51.5 bits, E=1.6e-17
• PF02798: GST_N
  • amino acids 3 to 69 (67 residues), 35.9 bits, E=1.2e-12
• PF13409: GST_N_2
  • amino acids 8 to 69 (62 residues), 33.3 bits, E=9e-12

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 80% identity to maq:Maqu_2512)

Predicted SEED Role

"Maleylacetoacetate isomerase (EC 5.2.1.2) / Glutathione S-transferase" in subsystem Gentisare degradation or Homogentisate pathway of aromatic compound degradation or Salicylate and gentisate catabolism (EC 5.2.1.2)

MetaCyc Pathways

• L-tyrosine degradation I (2/5 steps found)
• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450
• Styrene degradation
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18 or 5.2.1.2

Sequence Analysis Tools

See E4PRN6 at UniProt or InterPro

Protein Sequence (190 amino acids)

>HP15_3369 glutathione S-transferase-like protein (Marinobacter adhaerens HP15)
MKLIGSTTSPYVRRIRILLDEEPYEFLNLNIYGEGRDELRRNNPTLKIPVLEDGGKEIYD
SRIIARYISAKQGRDPLTWDQENQLTMIDGANDSAVTLLLSEKSGIDTGADLMFYNLQRE
RIMTTLRTLSAMAEEGQFEEWNYPAICLYCLVDWLDFRDLVDFSGVESLLSFRDSHRVYP
WVAETDPRNS