Protein Info for PGA1_c34720 in Phaeobacter inhibens DSM 17395

Annotation: phosphoribosyl transferase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF18912: DZR_2" amino acids 10 to 69 (60 residues), 52.4 bits, see alignment E=3.6e-18 PF00156: Pribosyltran" amino acids 147 to 239 (93 residues), 31.5 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: None (inferred from 64% identity to sil:SPO0071)

Predicted SEED Role

"Competence protein F homolog, phosphoribosyltransferase domain; protein YhgH required for utilization of DNA as sole source of carbon and energy"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ERX2 at UniProt or InterPro

Protein Sequence (242 amino acids)

>PGA1_c34720 phosphoribosyl transferase-like protein (Phaeobacter inhibens DSM 17395)
MLKARIQTAVSLIYPPRCLACGDWVDSDFGLCGPCWRDTPFISGTCCDGCGVALMGEGDG
FRLECDDCMAHPRPWQQGRAALSYEGTARRLILALKHGDRTEIARPAARWLTRAAATLLA
NAPLVAPVPLHWSRFLRRRYNQSDLLAKIVAQDADLDYCPDLLRRTRRTPSLEGQNRHQR
YTTLAQSIAAHPKHAERINGRIVLLVDDVMTSGATLSACSEACLDAGATGVRVAVLARVT
HS