Protein Info for Psest_3481 in Pseudomonas stutzeri RCH2

Annotation: molybdenum cofactor biosynthesis protein A, bacterial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 4 to 329 (326 residues), 375.6 bits, see alignment E=9.8e-117 PF04055: Radical_SAM" amino acids 17 to 178 (162 residues), 124.7 bits, see alignment E=6.5e-40 PF13353: Fer4_12" amino acids 21 to 122 (102 residues), 27.4 bits, see alignment E=5.9e-10 PF06463: Mob_synth_C" amino acids 184 to 311 (128 residues), 133.3 bits, see alignment E=7.5e-43

Best Hits

Swiss-Prot: 80% identical to MOAA1_PSEAE: GTP 3',8-cyclase 1 (moaA1) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 98% identity to psa:PST_0901)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRJ0 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Psest_3481 molybdenum cofactor biosynthesis protein A, bacterial (Pseudomonas stutzeri RCH2)
MTQLRDAHNRQIDYLRMSVTDRCDFRCVYCMAEDMTFLPRQQVLGLEELERIARIFVGLG
VKKIRLTGGEPLVRQGIVGLCERIAALPGLRELVMTTNGSQLVKLAAPLARAGVKRLNIS
LDSLDAEKFHAITRTGQLQQVLDGIDAARDAGFERIKLNAVVMKGRNAEEVADLVDFAIA
GGLDLSFIEEMPLGDVGRSRGESFCSSDEVRALIAERHALIDSAEQSGGPARYVRLADHP
QTRIGFISPHSHNFCATCNRVRLTVEGRLLLCLGHENSIDLRALLRRHPTSDQPVIDAIH
AALQRKPLRHEFSSSGEVQVLRFMNASGG