Protein Info for HP15_3358 in Marinobacter adhaerens HP15

Annotation: membrane-bound metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 58 to 77 (20 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 120 to 144 (25 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details PF04307: YdjM" amino acids 1 to 172 (172 residues), 124.5 bits, see alignment E=1.6e-40

Best Hits

KEGG orthology group: K09151, hypothetical protein (inferred from 74% identity to maq:Maqu_3601)

Predicted SEED Role

"Membrane-bound metal-dependent hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRM5 at UniProt or InterPro

Protein Sequence (342 amino acids)

>HP15_3358 membrane-bound metal-dependent hydrolase (Marinobacter adhaerens HP15)
MDSLTQAALGASLAGAVAGKTLGRSVLLTGAVLGTLPDLDVVIDYGTAVANFTQHRGFSH
SLFVLAPLAVALAWLLWRWKPQLSFQRWLALTGLILITHPLLDAFTTYGTQLFWPIGPPV
AVSSIFIIDPLYTLPLLAGCLFFLARPPAKTAIVAGLAVSTLYLGWSVLAQQVMTQRVQP
ALAAAGLENPDLLVQPMPFSTLLWRATALQGDQRVEIVTGFLDGDTPLNLEYFPRRPELA
SEVSDLPEARRLEWFTRGFLDYDQAGDRITATDIRLGIPGAHPFTFVLATRNGSGIDPTA
SFRTPRPPVSSEALGLLWSRMIAETPVLCLASLSSPAPGQSC