Protein Info for Psest_3474 in Pseudomonas stutzeri RCH2

Annotation: Short-chain dehydrogenases of various substrate specificities

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF08659: KR" amino acids 7 to 167 (161 residues), 61.4 bits, see alignment E=2.2e-20 PF00106: adh_short" amino acids 8 to 189 (182 residues), 135.2 bits, see alignment E=4.2e-43 PF01370: Epimerase" amino acids 8 to 137 (130 residues), 21.7 bits, see alignment E=2.4e-08 PF13561: adh_short_C2" amino acids 12 to 190 (179 residues), 82.6 bits, see alignment E=6.8e-27

Best Hits

KEGG orthology group: None (inferred from 88% identity to psa:PST_0908)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMJ8 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Psest_3474 Short-chain dehydrogenases of various substrate specificities (Pseudomonas stutzeri RCH2)
MQLRDARILLTGANGGIGRVLVERLCAGEARLLLVGRDSLALEALARRFPGQVSLVCADL
SQRSGRQTVLAAARRFGALNCVINAAGVNQFSLLEEQDEDAIARLIGVNVTATLQLTHLL
LPLLRQQPRALLVNLGSTFGSIGYPGFTAYCASKFALRGFSEALRRELADSHIKVLYVAP
RATRTAMNSADVVAMNNELKVEMDDPQEVARQIVHAITAEREELYLGWPEKLFVRLNGLL
PRLVDQALRKQLPVIKRFARAEQPLPPSQTTSTGDHP