Protein Info for Psest_3466 in Pseudomonas stutzeri RCH2

Annotation: Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 652 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 49 to 73 (25 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 179 to 196 (18 residues), see Phobius details PF00884: Sulfatase" amino acids 280 to 549 (270 residues), 146.8 bits, see alignment E=4.6e-47

Best Hits

KEGG orthology group: None (inferred from 72% identity to eba:ebA3316)

Predicted SEED Role

"Sulfatase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRF2 at UniProt or InterPro

Protein Sequence (652 amino acids)

>Psest_3466 Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily (Pseudomonas stutzeri RCH2)
MTLLRHAQLRYLSLLAGLWFGVFLITRGTLLFAHGQDAAAGPGELLRVFALGTIYDLAFL
TFATLPLGCYLMLCPQRLWANRWHQRGLTLLLALSLYAMLFTGLAEWLFWDEFGVRFNFI
AVDYLVYSDEVLRNILESYPVFALLALLALITLLATAVLQAPLKRALGAPSLPWRGRATV
LASLLGAATASGLIVGQDFPRGNGGNAYQRELASNGPFQFFAAFRNNELDYEQFYATQPE
RRVAEGLRAEVAEPNVRFIGQDPLDIRRVIDNPGQARKLNVVLITVESLSAKYLGSFGDS
RGLTPNLDQLRPQSLFFNNFYATGTRTDRGLEAITLSVPPTPGRSIVKRVGRESGFASLG
QQLQAQGYDSVFLYGGRGYFDNMSAFFSGNGYRVVDQSSVDEADMHFKNAWGMADEDLYR
LAIREADADYAVGKPFLLQLMTTSNHRPYTYPDGRIDIPSGEGREGAVKYTDATIGEFLH
NARSKPWFANTLFVIVADHTAGSAGSQDLPVASYHIPLFIYAPNLIEPREMNLVASQIDI
APTLLGLLNLDYVSTFFGRNLLRDDVQPGRALIGNYQHLGLFDGKDLAILSPRRGIRRHD
DALQASREASAGIDDPLVMRDIAYYQGASYDYGHALLSWKRPSSSATQLSQR