Protein Info for PGA1_c34520 in Phaeobacter inhibens DSM 17395

Annotation: alpha-ketoglutarate-dependent dioxygenase AlkB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 51% identical to ALKB_CAUVN: Alpha-ketoglutarate-dependent dioxygenase AlkB homolog (alkB) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03919, alkylated DNA repair protein [EC: 1.14.11.-] (inferred from 76% identity to sit:TM1040_0011)

Predicted SEED Role

"Alkylated DNA repair protein AlkB" in subsystem DNA repair, bacterial

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ERV4 at UniProt or InterPro

Protein Sequence (229 amino acids)

>PGA1_c34520 alpha-ketoglutarate-dependent dioxygenase AlkB (Phaeobacter inhibens DSM 17395)
MPPATARSRPVSRITAVFDRGAVKNGLTVMMKLRLRGFELTKPLLDMDGQQRLIECLRPI
LRAAPLFSPEVPGGGKMSVRMTSAGAYGWFSDRDGYRYEERHPTGRRWPEIPSEILDIWR
VITGLERQPDCCLINYYGEGARMGLHQDKDEADFSYPVVSVSLGDDGLLRIGNQSRGGKT
DTVWLNSGDVVVMGGDARLTYHGVDRIRFKSSRLLPKGGRINLTLRVVT