Protein Info for Psest_3463 in Pseudomonas stutzeri RCH2

Annotation: Methylase involved in ubiquinone/menaquinone biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF01209: Ubie_methyltran" amino acids 37 to 150 (114 residues), 21.3 bits, see alignment E=4.8e-08 PF13489: Methyltransf_23" amino acids 37 to 204 (168 residues), 30.8 bits, see alignment E=7.2e-11 PF13649: Methyltransf_25" amino acids 57 to 151 (95 residues), 52.7 bits, see alignment E=1.8e-17 PF13847: Methyltransf_31" amino acids 57 to 152 (96 residues), 32.3 bits, see alignment E=2.3e-11 PF08242: Methyltransf_12" amino acids 58 to 151 (94 residues), 32.2 bits, see alignment E=4.5e-11 PF08241: Methyltransf_11" amino acids 58 to 151 (94 residues), 45.1 bits, see alignment E=4e-15

Best Hits

KEGG orthology group: None (inferred from 97% identity to psa:PST_0915)

Predicted SEED Role

"SAM-dependent methyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ82 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Psest_3463 Methylase involved in ubiquinone/menaquinone biosynthesis (Pseudomonas stutzeri RCH2)
MPTSSPIELEFSRKYDRQHAYEYLHKHQDGLARRLSHWRDEQMARRALKIAGDPDLVLDL
PCGAGRFWPLLAKHPSRMIFAADNSADMLAIAEASQPLEVLKRVETFQTSAFAIDMGDNA
VDNIFCMRLLHHIADPAHRLAMLREFHRVTRDTLIVSLWVDGNYKAWKRKRLERRRPAKD
NQNRFVVARSVIEAEFAEAGFDILDRNDFLPGYAMWRVYVLRKRG