Protein Info for Psest_3460 in Pseudomonas stutzeri RCH2

Annotation: Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 708 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details PF00884: Sulfatase" amino acids 306 to 584 (279 residues), 177.4 bits, see alignment E=4.3e-56

Best Hits

KEGG orthology group: None (inferred from 88% identity to psa:PST_0918)

Predicted SEED Role

"Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRK5 at UniProt or InterPro

Protein Sequence (708 amino acids)

>Psest_3460 Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily (Pseudomonas stutzeri RCH2)
MIDGTARAQAGQPGLRQHLLFTTGSALALLALFALLRLALLLYNHELLGDASFATMLEGF
GNGLRFDLRVLVYMLVPLSLAVLSPRAMAARRLQRIWLGACASLAILLGMVELNFYQEFH
QRLNALVFQYLAEDPATVLSMLWHGFPVVKLLSVWAGLTLLWSLLFGWLDRHCRPNAALA
KRPVQSAQAGWSWRGTALLALVLISVVAARGTLRQGPPLRWGDAFTTDSVFINQLGLNPA
LTLYEAAKNRYSDHRDNAWKAVLPEDEALAVTRELLLTGNDQLADPELAAVRRDYRSPEA
GRLPVRNVVVILMESFAGRYVGALGNGDGITPNFDRLAGEGLLFERFFANGTHTHQGMFA
SMACFPNLPGFEYLMQSPEGGNRFSGLPQLLSARAFNDVYVYNGDFAWDNQLGFFGNQGM
TRFVGRSDYVDPVVADPTWGVSDQDMFDRAVQELGALAADEPFYALLQTLSNHTPYALPE
PLPVPAVSGHGSQDAHLTAMRYSDWALGRFFEQAKRQSWYKDTLFVVVGDHGFGAPEQLT
EMDLFRFHVPLLLIAPGITEQFGSRREVVGTQVDVVPTIMGRLGGEVRHQCWGRDLLALD
ERDPGFGIIKPSGSDQTVAMIRGDRILVQPRDLEPQLYRYRLGANAAAERIVDAASATPM
LRQLQAYLQVATASLLGNSTADREREETPAGEALARTANGPQARPDKG