Protein Info for Psest_3456 in Pseudomonas stutzeri RCH2

Annotation: RNA polymerase sigma factor, sigma-70 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF07638: Sigma70_ECF" amino acids 7 to 172 (166 residues), 33.4 bits, see alignment E=8.7e-12 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 19 to 173 (155 residues), 117 bits, see alignment E=3.3e-38 PF04542: Sigma70_r2" amino acids 23 to 90 (68 residues), 72.6 bits, see alignment E=3.8e-24 PF08281: Sigma70_r4_2" amino acids 120 to 172 (53 residues), 62.7 bits, see alignment E=4.2e-21 PF04545: Sigma70_r4" amino acids 125 to 172 (48 residues), 39.8 bits, see alignment E=5.1e-14

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 57% identity to tmz:Tmz1t_1920)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRE1 at UniProt or InterPro

Protein Sequence (186 amino acids)

>Psest_3456 RNA polymerase sigma factor, sigma-70 family (Pseudomonas stutzeri RCH2)
MNECEQELIQQAVRGDRQAFGALVRAHQARVFHFIRRLLGSTDEAADLTQETFIRAYQAL
PRWRPEARLQTWLLQIARNAALDLLRQRQRHVVLAADEQAEPIDPAPSPLRRLQSARDLE
MLERLLARLPHEQREILLLREVEGLSYDELAATLQLNAGTVKSRLARAREALLHGYRQAN
GGILDD