Protein Info for PGA1_c34440 in Phaeobacter inhibens DSM 17395

Annotation: putrescine transport system permease protein PotH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 76 to 98 (23 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 94 to 279 (186 residues), 58.8 bits, see alignment E=3.1e-20

Best Hits

Swiss-Prot: 43% identical to POTB_HAEIN: Spermidine/putrescine transport system permease protein PotB (potB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K11075, putrescine transport system permease protein (inferred from 86% identity to sit:TM1040_2982)

Predicted SEED Role

"Putrescine transport system permease protein PotH (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F3S5 at UniProt or InterPro

Protein Sequence (293 amino acids)

>PGA1_c34440 putrescine transport system permease protein PotH (Phaeobacter inhibens DSM 17395)
MRRFFLIAIPYAWLLALFLVPFAIVFKISLSDAAVARPPYMPQFDWVTGIGAFLSDLDFE
NFTWLTEDDLYWKAYLSSLRIAVVSTVLTLLVGYPMAYGMARAPSEWRPTLMMLVILPFW
TSFLIRVYAWMGILSNEGLLNQFLIWAGLIDTPLTILNTNTAVYIGIVYTYLPFMILPIY
SALERLDGSLIEAAEDLGCSRMEAFWLVTIPLSRAGIIAGCFLVFIPTLGEFVIPSLLGG
SDTLMIGKVLWEEFFSNRDWPVASAVAVVLLLILIVPIVLFQRNQQKQQEAEQ