Protein Info for HP15_3332 in Marinobacter adhaerens HP15

Annotation: phosphopantetheine adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 TIGR01510: pantetheine-phosphate adenylyltransferase" amino acids 4 to 157 (154 residues), 203.6 bits, see alignment E=1.7e-64 TIGR00125: cytidyltransferase-like domain" amino acids 4 to 63 (60 residues), 68.4 bits, see alignment E=4.7e-23 PF01467: CTP_transf_like" amino acids 5 to 133 (129 residues), 104.8 bits, see alignment E=4.1e-34 PF08218: Citrate_ly_lig" amino acids 11 to 71 (61 residues), 26.4 bits, see alignment E=5.3e-10

Best Hits

Swiss-Prot: 92% identical to COAD_MARHV: Phosphopantetheine adenylyltransferase (coaD) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K00954, pantetheine-phosphate adenylyltransferase [EC: 2.7.7.3] (inferred from 92% identity to maq:Maqu_3575)

MetaCyc: 59% identical to pantetheine-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Pantetheine-phosphate adenylyltransferase. [EC: 2.7.7.3]

Predicted SEED Role

"Phosphopantetheine adenylyltransferase (EC 2.7.7.3)" in subsystem Coenzyme A Biosynthesis (EC 2.7.7.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRJ9 at UniProt or InterPro

Protein Sequence (158 amino acids)

>HP15_3332 phosphopantetheine adenylyltransferase (Marinobacter adhaerens HP15)
MSKVIYPGTFDPITNGHTDLIERAGRMFDEIVVAIAYNPKKQPLLDLEERCELVRQATAH
LPNVTVTGFSNLLADFVREQGATVILRGLRAVSDFEYEFQLADMNRRLAPEVESVFLTPA
NHLSYISSTLIREIASLGGDVSEFVDPAVEAALKKKFN