Protein Info for PGA1_c03500 in Phaeobacter inhibens DSM 17395

Annotation: putative cell division ATP-binding protein FtsE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF00005: ABC_tran" amino acids 17 to 164 (148 residues), 107.2 bits, see alignment E=1.1e-34

Best Hits

Swiss-Prot: 43% identical to FTSE_HAEIN: Cell division ATP-binding protein FtsE (ftsE) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K09812, cell division transport system ATP-binding protein (inferred from 87% identity to sit:TM1040_3498)

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DX98 at UniProt or InterPro

Protein Sequence (225 amino acids)

>PGA1_c03500 putative cell division ATP-binding protein FtsE (Phaeobacter inhibens DSM 17395)
MIELDNVGYNYGGGELLSEVSVQLAPGSFHFLTGPSGAGKTTLLKLCYGALTPTSGRARA
FNMDINGLDRDQMAYLRRRIGVVHQDCRFLDHLPVIENIALPLTVSGRDIDQEEANLREL
LNWVGLSERAHATPPELSGGERQRAALARSVILSPEVIIADEPTGNVDWEMSQRLLQLLV
ELNHMGKTVLVATHDLSLIRAAKKQVQARVLRISNRQLQQAGADL