Protein Info for Psest_3453 in Pseudomonas stutzeri RCH2

Annotation: Flavodoxin reductases (ferredoxin-NADPH reductases) family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 signal peptide" amino acids 7 to 8 (2 residues), see Phobius details transmembrane" amino acids 9 to 25 (17 residues), see Phobius details amino acids 31 to 52 (22 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 7 to 166 (160 residues), 45.7 bits, see alignment E=1.3e-15 PF00970: FAD_binding_6" amino acids 190 to 287 (98 residues), 43.3 bits, see alignment E=8e-15 PF00175: NAD_binding_1" amino acids 298 to 394 (97 residues), 40.5 bits, see alignment E=7.5e-14 PF00111: Fer2" amino acids 436 to 510 (75 residues), 62.6 bits, see alignment E=5.3e-21

Best Hits

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ71 at UniProt or InterPro

Protein Sequence (518 amino acids)

>Psest_3453 Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 (Pseudomonas stutzeri RCH2)
MAAFKRFRLFHWLLAGFFVAVYLSGDDAELLHVWLGYGLVALLVMRLLIAPLRLRGVPRL
LPAKMQRRNLSLTSFGTWLTFATLLSLALASLLGLGMVDNGDVLAALPGVGPDLFGSASD
IDFVGWLGDAEEVHEFFANLALTLVALHIGYVVLFRRTAAWAMLRGPRQPAEPGAPVSVA
ASEAPAFAALTVIARQAETADAASFSLQVPAELRERFAAQPGQFVTLRVPCSEPPLLRSY
SLSKPLGSDGVLRISVRRVPGGRASNWLLDNLQVGQRIDVLPPAGRLVPHDLDGDLLLLG
AGSGITPLRAILQAALEQGRGRVFLFYASRDAASLIFAEELADFAARYPERLQLRIWLDA
EQGIPSAPAIAAKIGDWPQGEAFVCGPQPFMDGASVALAELDVSSDAIHVERFNTAAPVA
PLSELRQPLHSRLQVALDGRRHALDVQQGEVLLDAMEQAGLQPPSACRAGVCAACRCRVV
EGSVSMRSNQVLSDQQVRQGWTLACQAVPTSTRLAVEY