Protein Info for Psest_3451 in Pseudomonas stutzeri RCH2

Annotation: tRNA (uracil-5-)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 TIGR02143: tRNA (uracil(54)-C(5))-methyltransferase" amino acids 28 to 380 (353 residues), 583.3 bits, see alignment E=8e-180 PF05958: tRNA_U5-meth_tr" amino acids 28 to 379 (352 residues), 559.2 bits, see alignment E=5.5e-172 PF13649: Methyltransf_25" amino acids 229 to 288 (60 residues), 28.5 bits, see alignment E=3.1e-10

Best Hits

Swiss-Prot: 95% identical to TRMA_PSEU5: tRNA/tmRNA (uracil-C(5))-methyltransferase (trmA) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00557, tRNA (uracil-5-)-methyltransferase [EC: 2.1.1.35] (inferred from 95% identity to psa:PST_0919)

MetaCyc: 52% identical to tRNA m5U54 methyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA (uracil-5-)-methyltransferase. [EC: 2.1.1.35]

Predicted SEED Role

"tRNA (Uracil54-C5-)-methyltransferase (EC 2.1.1.35)" (EC 2.1.1.35)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRD4 at UniProt or InterPro

Protein Sequence (380 amino acids)

>Psest_3451 tRNA (uracil-5-)-methyltransferase (Pseudomonas stutzeri RCH2)
MGAAGAVKLLKPLHEAPAMPLPKLDPAQYETQLAEKAARLVELLAPFDAPAPEVFDSPRE
HYRLRTEFRLWREDGQRHYAMFEQGDKHKAILIDDFPIASRRINELMPQLKAAWQASEVL
SFKLFQVEFLTTLAGDALITLAYHRPLDEAWQAEAEQLAANLGVSLVGRSKGKRIVIGRD
YVEEALVVAGRTFRYRQPEGAFTQPNGEVCQKMLNWAFEALGERDDDLLELYCGNGNFTL
PLATRVRRVLATEISKTSVNAALANIADTGIDNIELVRLSAEELTQALNEVRPFRRLADI
DLKSYDFGSVFVDPPRAGMDPDTCELTRRFERILYISCNPETLAQNIAQLADTHRIERCA
LFDQFPYTHHMESGVLLVRR