Protein Info for PGA1_c34370 in Phaeobacter inhibens DSM 17395

Annotation: spermidine/putrescine transport system permease protein PotB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 202 to 229 (28 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details amino acids 388 to 411 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 221 to 412 (192 residues), 55.8 bits, see alignment E=2.6e-19

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 70% identity to pgv:SL003B_2643)

Predicted SEED Role

"polyamine ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ERT7 at UniProt or InterPro

Protein Sequence (423 amino acids)

>PGA1_c34370 spermidine/putrescine transport system permease protein PotB (Phaeobacter inhibens DSM 17395)
MSDTTHTGPVLAADGTPLKRSLARALRMQKIRALMLIAPLLLFVLLTFILPIADMLFRSV
ENKIVSDTLPKTVVALKDWDANSGETPDEAIFAALAADLQVAAQEKTHTRVGSRLNYENP
GISSLFRKAGRKVKRWDLAEDGPFREQFIKIDEDWADPEVWRTIQTYSGAYTNGYFLNAA
DFQKGAEGAELRPENERIYGTLFLRTLIMSLAITVSCIVLGYPVAWILANLPSRTANLLM
ILVLLPFWTSLLVRTSAWKVMLQQQGVINDTLVWLGLVADDARLVMINNQFGTIVAMTHI
LLPFMILPMYSVMQTINPSYLRAAKSLGATNWTAFWRVYFPQSVPGIGAGSILVFILAIG
YYITPELVGGTKGVFISNRIAFHISQSLNWGLAAALGSILLVVVLALYWAYDKIVGIDNV
KLG