Protein Info for PGA1_c34360 in Phaeobacter inhibens DSM 17395

Annotation: spermidine/putrescine transport system permease protein PotC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 124 to 147 (24 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details amino acids 308 to 333 (26 residues), see Phobius details amino acids 354 to 378 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 202 to 381 (180 residues), 51.2 bits, see alignment E=6.5e-18

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 89% identity to sit:TM1040_2990)

Predicted SEED Role

"Polyamine ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F1E2 at UniProt or InterPro

Protein Sequence (391 amino acids)

>PGA1_c34360 spermidine/putrescine transport system permease protein PotC (Phaeobacter inhibens DSM 17395)
MALTPVENQTPGFVALVAAAAGAFFGLFVGTAQGSGLLGVLIGAALVGGLGFALAGMRDQ
ERLIRWILIAAFAVAGFVMGGLPAAVMGLLFGAFVGWFIFWLSTSRYRVHLAPYLTPGQV
LWHYTFRVICGAIFIFLITPILVVMPLSFNAQDFFTFTPEMIRFDPEGYSLKHYRDFFTN
ADWQQAMWNSIKIAPMATILSVGFGTLAAIGLSQPHVPFRRAIMAILISPMIVPLIISAA
GMYFFYSRIGLQGTYFGVVLAHAALGIPFVIITVTATLVGFDRSLTRAAANMGAGPVTTF
FRVQMPLILPGVISGGLFAFITSFDEVVVVLFVGSAGQKTLPWQMFIGLREQISPTILAV
ATILVVVSICLLTVVEMLRRRSERLRGMSPS