Protein Info for PGA1_c34330 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): 2-amino-3-ketobutyrate coenzyme A ligase (EC 2.3.1.29)
Rationale: Specifically important for utilizing L-Threonine. Automated validation from mutant phenotype: the predicted function (AKBLIG-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: 2-amino-3-ketobutyrate coenzyme A ligase Kbl

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 TIGR01822: glycine C-acetyltransferase" amino acids 9 to 394 (386 residues), 628.4 bits, see alignment E=2.3e-193 PF00155: Aminotran_1_2" amino acids 43 to 383 (341 residues), 220.1 bits, see alignment E=5.4e-69 PF01041: DegT_DnrJ_EryC1" amino acids 88 to 215 (128 residues), 19.9 bits, see alignment E=4e-08

Best Hits

Swiss-Prot: 63% identical to KBL_ECOLI: 2-amino-3-ketobutyrate coenzyme A ligase (kbl) from Escherichia coli (strain K12)

KEGG orthology group: K00639, glycine C-acetyltransferase [EC: 2.3.1.29] (inferred from 86% identity to sil:SPO3360)

MetaCyc: 63% identical to 2-amino-3-ketobutyrate CoA ligase (Escherichia coli K-12 substr. MG1655)
Glycine C-acetyltransferase. [EC: 2.3.1.29]

Predicted SEED Role

"2-amino-3-ketobutyrate coenzyme A ligase (EC 2.3.1.29)" in subsystem Glycine Biosynthesis or Glycine and Serine Utilization (EC 2.3.1.29)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E5F5 at UniProt or InterPro

Protein Sequence (395 amino acids)

>PGA1_c34330 2-amino-3-ketobutyrate coenzyme A ligase (EC 2.3.1.29) (Phaeobacter inhibens DSM 17395)
MSTDFLTDISKTLEEIKADGLYKRERMITSPQGGEIRVGDAAVINLCANNYLGLADHPDL
IAAARGVMDDKGFGMASVRFICGTQDIHRELEQRLAKFLGKDDAILFAACFDANGGLFEP
LLGPEDAIISDSLNHASIIDGIRLCKAKRYRYLNSDMNDLEAWLKQAREDGARHIMIATD
GVFSMDGYLAKLPEIRALADKYDAIVMVDDCHATGFMGATGAGTPEHFGVDVDIVTGTLG
KALGGAIGGYIAGPQPVIDLLRQRARPYLFSNSLPPSIVAAGLEAIRLVEEGNGLRAQLF
ENAKYWRAGLEKLGFDLLPGEHPIIPVMLGEAQLAQDMASRLFDEGVYVSGFFFPVVPRG
QARIRTQMNAALTRDELDRALAAFGKVGKELGILS