Protein Info for Psest_3443 in Pseudomonas stutzeri RCH2

Annotation: Predicted acyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 169 to 186 (18 residues), see Phobius details amino acids 198 to 215 (18 residues), see Phobius details amino acids 231 to 249 (19 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 288 to 313 (26 residues), see Phobius details amino acids 325 to 344 (20 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 8 to 393 (386 residues), 133.3 bits, see alignment E=5.2e-43

Best Hits

KEGG orthology group: None (inferred from 96% identity to psa:PST_0927)

Predicted SEED Role

"Lysophospholipid acyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ60 at UniProt or InterPro

Protein Sequence (412 amino acids)

>Psest_3443 Predicted acyltransferases (Pseudomonas stutzeri RCH2)
MPRTEHFIGLEWLRFLLAIYVVLFHTVHAYVEGEPTWLAELAGVGFFATSSFFVLSGFLL
AHVYCRQGELREPARHFLGKRLANLYPLHLFSLLLTAIVLTIIAKLGIPPDDAKASLRYV
VYDTNEELSGEARDALEYFMNNRELALNFVLQLFMLQAWNPLYLTFNPPLWSISTLFFFY
LCFPLLAPRLMRLRHKGWWLLAIAALYLLPPLWAIQQDAYGIPVTGMLHRMPLLRLPEFL
AGILLCGLFREWRAAGGQLGIAARLALSAFVLASFLATVWLLKGERYWYFLLHNGLLLPA
QLALVWLCALIATPRSAALIDWSQRLGAASLPLFVLHVPVFILFSRSEKLLGAVSAECLE
DWADCVAQAGELALTPAFYPLYLGLCIVVCVLAQERAVVPVRRFLLRRVMKV