Protein Info for Psest_3440 in Pseudomonas stutzeri RCH2

Annotation: 16S RNA G1207 methylase RsmC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF26049: RLMG_N
  • amino acids 2 to 181 (180 residues), 215.1 bits, E=2.4e-67
• PF05175: MTS
  • amino acids 201 to 371 (171 residues), 174.9 bits, E=3.9e-55
• PF13847: Methyltransf_31
  • amino acids 233 to 339 (107 residues), 33.8 bits, E=9.8e-12
• PF13649: Methyltransf_25
  • amino acids 235 to 335 (101 residues), 27.7 bits, E=1.3e-09

Best Hits

Swiss-Prot: 92% identical to RLMG_PSEU5: Ribosomal RNA large subunit methyltransferase G (rlmG) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 92% identity to psa:PST_0932)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmG (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.172

Use Curated BLAST to search for 2.1.1.- or 2.1.1.172

Sequence Analysis Tools

See L0GRI4 at UniProt or InterPro

Protein Sequence (375 amino acids)

>Psest_3440 16S RNA G1207 methylase RsmC (Pseudomonas stutzeri RCH2)
MPILDTPYASLDLIRQPEQPNEPLQAFDAADEYLLATLHEQGLPAAARVLILNDSFGALA
CALAAHVEVTSSGDSHLAHLALQKNLARNGISETRVTFVPASEMAQGPFDLVLIRVPKTL
ALLEEQLIRLHGQLSPGAQVIAAAMIKHLPRAAGDLLEQYIGAVQASLAVKKARLLSATA
SEKPAPQSPYPTRYRLDQPKLELLNHANLFCREGLDIGTRAFLPHLPQALGALRVADLGC
GNGVLGIVYALGNPQAELTLVDESYMAVQSARENWQAILGERPADIRAGDGLAEQAPGSL
DLVLCNPPFHQQQVVGDFLAWRMFTQAKAALAKGGELWIVGNRHLGYHLKLKRLFGNAEQ
VAATPKFVIIKATRA