Protein Info for PGA1_c34280 in Phaeobacter inhibens DSM 17395

Annotation: peptide methionine sulfoxide reductase MsrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00357: methionine-R-sulfoxide reductase
  • amino acids 9 to 138 (130 residues), 188.6 bits, E=2.2e-60
• PF01641: SelR
  • amino acids 12 to 128 (117 residues), 163.3 bits, E=1.1e-52

Best Hits

Swiss-Prot: 78% identical to MSRB_BRUSU: Peptide methionine sulfoxide reductase MsrB (msrB) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 92% identity to sit:TM1040_2803)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.12

Sequence Analysis Tools

See I7E5E9 at UniProt or InterPro

Protein Sequence (149 amino acids)

>PGA1_c34280 peptide methionine sulfoxide reductase MsrB (Phaeobacter inhibens DSM 17395)
MRSYSKDPDAIAALSEEEFYVTQNAGTERPGTGKLLGNKEPGIYVDIVSGEPLFASADKY
ESGCGWPSFTKPIEPAHVQELEDRTLGMIRTEVRSTHGDSHLGHVFPDGPADRGGLRYCI
NSASLRFVHLDDMRAEGYGDYIDQVEDRR