Protein Info for HP15_3315 in Marinobacter adhaerens HP15

Annotation: acetylornithine deacetylase (ArgE)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 TIGR01892: acetylornithine deacetylase (ArgE)" amino acids 16 to 383 (368 residues), 407.7 bits, see alignment E=2.3e-126 PF04389: Peptidase_M28" amino acids 69 to 169 (101 residues), 23.6 bits, see alignment E=5.8e-09 PF01546: Peptidase_M20" amino acids 83 to 385 (303 residues), 127.7 bits, see alignment E=8.9e-41 PF07687: M20_dimer" amino acids 184 to 292 (109 residues), 83.6 bits, see alignment E=1.4e-27

Best Hits

Swiss-Prot: 52% identical to ARGE_PROMH: Acetylornithine deacetylase (argE) from Proteus mirabilis (strain HI4320)

KEGG orthology group: K01438, acetylornithine deacetylase [EC: 3.5.1.16] (inferred from 88% identity to maq:Maqu_3558)

MetaCyc: 50% identical to acetylornithine deacetylase (Escherichia coli K-12 substr. MG1655)
Acetylornithine deacetylase. [EC: 3.5.1.16]

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PRI2 at UniProt or InterPro

Protein Sequence (389 amino acids)

>HP15_3315 acetylornithine deacetylase (ArgE) (Marinobacter adhaerens HP15)
MSQSDSKSAVVPGIRDMLARLISLPSISSASAKWDHSNEPVVRTLAEWLEALGFSVEILE
VPGMPGKFNLIGTLGSGPGGLVLSGHTDTVPFDDKRWQSDPFTLTERDNRWYGLGTCDMK
GFFPLAIEAARAFVDEDLKQPLIILATADEESSMDGARALAEAGKPKARYAVIGEPTSLK
PVRMHKGIMMERLKFEGQSGHSSNPALGRNAMEGMHEALTELLALRSGWQEKYRNPNFEV
QFPTLNLGCIHGGDNPNRICAQCELHFDLRPLPGMNMETLRQAILSKVQPIADRRELSLE
FEPLFDGVPPFETPADAALVKACEKLTGHTAHAVAFATEAPWLQKLGLETLVMGPGSIDQ
AHQPDEFIELSQIDPTVKVLRGLIRQFCL