Protein Info for Psest_0338 in Pseudomonas stutzeri RCH2

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 736 PF11563: Protoglobin" amino acids 19 to 165 (147 residues), 88.1 bits, see alignment E=1.6e-28 TIGR00229: PAS domain S-box protein" amino acids 170 to 294 (125 residues), 35.2 bits, see alignment E=1.2e-12 PF08447: PAS_3" amino acids 197 to 276 (80 residues), 49.1 bits, see alignment E=1.4e-16 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 297 to 455 (159 residues), 133.2 bits, see alignment E=7.2e-43 PF00990: GGDEF" amino acids 300 to 453 (154 residues), 147.4 bits, see alignment E=8.4e-47 PF00563: EAL" amino acids 475 to 710 (236 residues), 214.5 bits, see alignment E=3.6e-67

Best Hits

KEGG orthology group: None (inferred from 88% identity to psa:PST_3911)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI13 at UniProt or InterPro

Protein Sequence (736 amino acids)

>Psest_0338 PAS domain S-box/diguanylate cyclase (GGDEF) domain (Pseudomonas stutzeri RCH2)
MEDELKALLQRVGLGLDQILVRKRYLQWQASDGLRLNRAAAELESAHPAFIEKLYEHLNA
FGQPSAMQNDCVGIARLKQRQLEYYRRLWSGPYERDYVRDRLLVGLVHQRVGVDLEWYLG
AYRLYLSEMLRTLLGDGDQHALYDSLLKIVFFDMILAIDTYSAAQRHALEDSEARLTRAL
RGSEDGIWEWDVERDQLHLSERWTAMLGMPMQAGYCSRGWFERVHPDDLPGLREAIAAHL
NGHSPSLAHEYRVRMETGEYLWVLVRGVAERCEQGTLRMAGSQTDISARKAAEECLRHAA
RHDALTGLANRLHLDELLKEVQQRPYGRAAALLFIDLDRFKLINDSLGHGAGDQVLVEVA
QRLLHCLRPGDHLARFGGDEFVALLGDLACEADAERVAQRMLVALREPLQLGERTLSVSA
SIGIAPLQRDGQALNVLQAADLALYRAKSAGKDQFALFCDGLHSKAARQLELESALAQAL
TRREFTLHYQPICRVEQGQPYLLGVEALLRWRFEDKPVAPMEFIPVLEESREIVRVGEWV
LREACRQVRRWQQAGQTQLYCAVNLSIRQLQQVDFAELLARVLRETGLPPQSLLLEITET
LLMHDSEMMLNCLHEVAALGVRLALDDFGTGYCSLGYLKRYPLHVLKVDRSFIAAAPDDA
DSVAISGAIIGLGQSLGLAVVAEGVERPEQIEFLVAQGCRAVQGYWFSPPRPAPELQALF
DGTRRADGLWGLQQLR