Protein Info for Psest_3433 in Pseudomonas stutzeri RCH2

Annotation: ATP-binding cassette protein, ChvD family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 TIGR03719: ATP-binding cassette protein, ChvD family" amino acids 12 to 562 (551 residues), 975.5 bits, see alignment E=7.7e-298 PF00005: ABC_tran" amino acids 31 to 200 (170 residues), 94.6 bits, see alignment E=1.6e-30 amino acids 349 to 482 (134 residues), 80.1 bits, see alignment E=5e-26 PF12848: ABC_tran_Xtn" amino acids 239 to 313 (75 residues), 45.3 bits, see alignment E=1.5e-15

Best Hits

Swiss-Prot: 73% identical to ETTA_HAEIN: Energy-dependent translational throttle protein EttA (ettA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 96% identity to psa:PST_0939)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system ATP-binding protein" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ50 at UniProt or InterPro

Protein Sequence (564 amino acids)

>Psest_3433 ATP-binding cassette protein, ChvD family (Pseudomonas stutzeri RCH2)
MSKSDKAGKTGSYVYTMHRLSKVVPPKREILKNISLSFFPGAKIGVLGLNGAGKSTLLRI
MAGVDTEFDGEARAMPGINVGYLPQEPQLDPEKTVREVVEEAVGVIKDAQARLDAVYAAY
AEPDADFDALAAEQAKLEAILQASDGHNLERQLEVAADALRLPAWDAKVAHLSGGEKRRV
ALCRLLLSAPDMLLLDEPTNHLDADSVAWLERFLHDFPGTVVAITHDRYFLDNVAGWILE
LDRGAGIPYEGNYSGWLEAKSARLAQESKQQSAHEKAMKEELEWVRKGAKARQSKSKARL
QRFEEMQSQEFQKRAETNEIYIPAGPRLGDKVIEFKNVTKGYGDRVLIDNLSFSVPKGAI
VGVIGGNGAGKSTLFRMLMGKETPDSGSIEIGDTVQLACVDQSRDDLEGGKTVWEAVSDG
LDQIRIGNYEVPSRGYVGRFNFKGADQQKFVKDLSGGERGRLHLALTLKQGANVLLLDEP
SNDLDVETLRSLEEALLDFPGSAIVISHDRWFLDRVATHILSYEDDGGVVFFEGNYTEYE
ADRKRRLGDAASQPHRVRYKKLAQ