Protein Info for PGA1_c34170 in Phaeobacter inhibens DSM 17395

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase Dxs

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 10 to 287 (278 residues), 380 bits, E=1.3e-117
• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 12 to 632 (621 residues), 780 bits, E=8.8e-239
• PF02779: Transket_pyr
  • amino acids 324 to 485 (162 residues), 144.3 bits, E=6.2e-46
• PF02780: Transketolase_C
  • amino acids 501 to 624 (124 residues), 100.7 bits, E=1.1e-32

Best Hits

Swiss-Prot: 90% identical to DXS_RUEST: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 90% identity to sit:TM1040_2920)

MetaCyc: 55% identical to 1-deoxy-D-xylulose 5-phosphate synthase (Arabidopsis thaliana col)
1-deoxy-D-xylulose-5-phosphate synthase. [EC: 2.2.1.7]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (12/12 steps found)
• taxadiene biosynthesis (engineered) (12/13 steps found)
• methylerythritol phosphate pathway I (9/9 steps found)
• methylerythritol phosphate pathway II (9/9 steps found)
• isoprene biosynthesis I (9/10 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• superpathway of thiamine diphosphate biosynthesis II (8/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• superpathway of thiamine diphosphate biosynthesis I (6/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (7/12 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Sequence Analysis Tools

See I7ERR6 at UniProt or InterPro

Protein Sequence (642 amino acids)

>PGA1_c34170 1-deoxy-D-xylulose-5-phosphate synthase Dxs (Phaeobacter inhibens DSM 17395)
MSDRPQTPLLDQITRPADLKSLSDAQLTQVAQELRQETISAVSVTGGHLGAGLGVVELTT
ALHAVFDTPRDKIIWDVSHQCYPHKILTGRRDRIRTLRMKDGLSGFTKRSESPFDPFGAA
HSSTSISAALGFAVARDLGGVVPEGLGDAIAVIGDGSMSAGMAFEAMNNAGHLGKRLIVI
LNDNEMSIAPPVGALSSYLSRLYAEEPFQELKAVAKGAASLLPEPFREGAKRAKDMLKGM
AVGGTLFESLGFSYLGPIDGHDMDQLLPVLRTVKARATGPILIHVLTKKGKGYAPAEAAR
DKGHATAKFDMVTGEQKKAPSNAPSYTSVFGKELVRLAAEDDKICAVTAAMPDGTGLSLM
AERYPSRTFDVGIAEQHGVTFAAALAAGGMKPFCAMYSTFLQRGYDQVVHDVAIQRLPVR
FAIDRAGLVGADGATHAGSFDIAYMANLPGMVVMAAADEAELAHMTATAAAYDDGPIAFR
YPRGEGEGVDMPEAPEVLEIGKGRMIQEGKRVAILSFGTRLGEVRKAAEALSARGITPTI
ADARFAKPLDRDMILKLAADHEALITIEEGAVGGFGSHVAQLLAEEGIFDSGLKYRSMVL
PDTFIDQASPADMYNVAAMNAPQIEAKVLEVLGVASIGEKRA