Protein Info for HP15_3302 in Marinobacter adhaerens HP15

Annotation: sterol desaturase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 163 to 199 (37 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 110 to 245 (136 residues), 114.6 bits, see alignment E=2.2e-37

Best Hits

KEGG orthology group: K00258, [EC: 1.3.-.-] (inferred from 70% identity to abo:ABO_0114)

Predicted SEED Role

"Sterol desaturase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.-.-

Use Curated BLAST to search for 1.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PR09 at UniProt or InterPro

Protein Sequence (328 amino acids)

>HP15_3302 sterol desaturase family protein (Marinobacter adhaerens HP15)
MALTDMILAVLEDSGLLSLWAMAAPWLALDERQLIFVIATPVFVGVTLWEYLKIRHDPQL
MDTREAVRNFALGAGYQVTELLFAGLIAFPVYALCYHYRLFDLELNGFTVLLAFLGVDFC
FYWMHRASHRVRWFWAAHVVHHSSERMNFSTAMRQNATNIFNGMWVFYLPLALLGLNPVW
IGVAYALSLVYQFFIHTTLVGKLPGWVELVFNTPSHHRVHHGRNPGYIDRNYGGTLIVWD
RLFGTFVDENAQDPPEYGITRPVRSNNLIVLWTHEYVDLFRDMAQPGGLLSRLTHLWKPP
EWQRPAAEKNNKEPGRDNERTPSDAEQW