Protein Info for PGA1_c03470 in Phaeobacter inhibens DSM 17395

Annotation: diaminopimelate decarboxylase LysA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 TIGR01048: diaminopimelate decarboxylase" amino acids 7 to 415 (409 residues), 476.3 bits, see alignment E=3.3e-147 PF00278: Orn_DAP_Arg_deC" amino acids 30 to 373 (344 residues), 102.6 bits, see alignment E=1.8e-33 PF02784: Orn_Arg_deC_N" amino acids 36 to 281 (246 residues), 203.9 bits, see alignment E=4.1e-64 PF01168: Ala_racemase_N" amino acids 56 to 232 (177 residues), 28.9 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 52% identical to DCDA_VIBCH: Diaminopimelate decarboxylase (lysA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 87% identity to sit:TM1040_3495)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.20

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DLQ6 at UniProt or InterPro

Protein Sequence (421 amino acids)

>PGA1_c03470 diaminopimelate decarboxylase LysA (Phaeobacter inhibens DSM 17395)
MDHFLYRDGALYAEDVPVAEIAATVGTPFYLYSTATLLRHFNLFDDALKGMDHLVCYAMK
AASNQAILKTLAQAGAGMDVVSQGEYLRAKAAGVPGDRIVFSGVGKTQDEIRTALSGGIR
QFNVESEPEMDVINAVALELGVVAPITVRVNPDVDAKTHAKIATGKSENKFGIPIARARE
VYARAASLPGLKVIGIDVHIGSQLTELAPFELAYQKVAELTEQLRADGHDIHRLDLGGGL
GIPYTRSNDTPPLPVEYGAMVQRTLGHLGCEIEIEPGRLIAGNAGIMVSKVIYVKSGEDR
DFLIIDGAMNDLIRPAMYEAYHDIVPVIEPSAGVEQRAYDIVGPVCETGDTFARHRDMPP
LEAGDLVAFRSAGAYGAVMASEYNSRPLIPEVLVNGDQFAVIRRRPDFDEMINRDTIPEW
L