Protein Info for PGA1_c34100 in Phaeobacter inhibens DSM 17395

Annotation: organic hydroperoxide resistance protein Ohr

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 TIGR03561: peroxiredoxin, Ohr subfamily" amino acids 6 to 140 (135 residues), 168.1 bits, see alignment E=6.1e-54 PF02566: OsmC" amino acids 40 to 140 (101 residues), 53.1 bits, see alignment E=1.9e-18

Best Hits

Swiss-Prot: 56% identical to Y3023_ACIAD: Uncharacterized protein ACIAD3023 (ACIAD3023) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: None (inferred from 74% identity to sit:TM1040_2927)

Predicted SEED Role

"Organic hydroperoxide resistance protein" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DVE8 at UniProt or InterPro

Protein Sequence (142 amino acids)

>PGA1_c34100 organic hydroperoxide resistance protein Ohr (Phaeobacter inhibens DSM 17395)
MSVSPVYTASATATGGRDGKASIHDSDLSFDLDPPKEMGGGGNGSNPEQLFAAGYAACYI
GAMKFATTQDDSLAKVPNDVSVHAEVGIGPRDEGGFGLTVALKVALPGLSPEEAKAVTEA
GHKICPYSNAVRGNVTVTTELV