Protein Info for PGA1_c34060 in Phaeobacter inhibens DSM 17395

Annotation: chorismate synthase AroC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF01264: Chorismate_synt" amino acids 10 to 353 (344 residues), 442.3 bits, see alignment E=4e-137 TIGR00033: chorismate synthase" amino acids 10 to 357 (348 residues), 438.3 bits, see alignment E=9.1e-136

Best Hits

Swiss-Prot: 92% identical to AROC_RUEST: Chorismate synthase (aroC) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K01736, chorismate synthase [EC: 4.2.3.5] (inferred from 92% identity to sit:TM1040_2819)

MetaCyc: 58% identical to chorismate synthase (Escherichia coli K-12 substr. MG1655)
Chorismate synthase. [EC: 4.2.3.5]

Predicted SEED Role

"Chorismate synthase (EC 4.2.3.5)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 4.2.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F1B0 at UniProt or InterPro

Protein Sequence (368 amino acids)

>PGA1_c34060 chorismate synthase AroC (Phaeobacter inhibens DSM 17395)
MSINSFGHLFRVTTWGESHGPALGATVDGCPPNVPVDAEMLQQWLDKRRPGQNKNMTQRN
EPDAVKILSGVFEGKSTGTPIQLMIENTDQRSKDYGDIAQTFRPGHADITYFQKYGNRDY
RGGGRSSARETAARVAAGGVAREAIKALVPGLEIKGYMTRMGEMEIDRSRFDWDAIDQND
FWIPDAAAVQDWENYLQGLRKEHDSVGAVIEVVARGVPAGIGAPIYGKLDTDLASAMMSI
NAVKAVEIGEGMNAALLKGSENADEIFLGEDGQPVYSSNHSGGILGGISTGQDVVVRFAV
KPTSSILTPRQSIRKDGSAAEVITKGRHDPCVGIRAVPVAEAMMACVILDHLLLHRGQVG
ENQGHIGG