Protein Info for PGA1_c34000 in Phaeobacter inhibens DSM 17395

Annotation: ubiquinol-cytochrome c reductase iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details PF10399: UCR_Fe-S_N" amino acids 1 to 41 (41 residues), 80.2 bits, see alignment 5.6e-27 TIGR01416: ubiquinol-cytochrome c reductase, iron-sulfur subunit" amino acids 10 to 186 (177 residues), 219.9 bits, see alignment E=2.3e-69 TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 10 to 38 (29 residues), 26 bits, see alignment 8.3e-10 PF00355: Rieske" amino acids 117 to 172 (56 residues), 41 bits, see alignment E=1.4e-14

Best Hits

Swiss-Prot: 76% identical to UCRI_PARDE: Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA) from Paracoccus denitrificans

KEGG orthology group: K00411, ubiquinol-cytochrome c reductase iron-sulfur subunit [EC: 1.10.2.2] (inferred from 86% identity to sit:TM1040_2814)

Predicted SEED Role

"Ubiquinol-cytochrome C reductase iron-sulfur subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DVD6 at UniProt or InterPro

Protein Sequence (186 amino acids)

>PGA1_c34000 ubiquinol-cytochrome c reductase iron-sulfur subunit (Phaeobacter inhibens DSM 17395)
MSHAEDNEGTRRDFLYYATAGAGAVTAGAAIWPLVNQMNPSADVQALSSIIVDVSGVEVG
TQLSVMFLGKPVFIRRRTEEEIEEARAVDLAELPDQQDRNANKPGLDASDENRTLDDAGE
WLVMMGVCTHLGCVPLGDGAGDFNGWFCPCHGSHYDTAGRIRKGPAPENLPVPAAEFIDE
TTIQLG