Protein Info for PGA1_c33970 in Phaeobacter inhibens DSM 17395

Annotation: putative chloramphenicol phosphotransferase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF07931: CPT" amino acids 4 to 162 (159 residues), 116.7 bits, see alignment E=1e-37 PF13671: AAA_33" amino acids 5 to 136 (132 residues), 34.8 bits, see alignment E=1.9e-12

Best Hits

KEGG orthology group: None (inferred from 64% identity to sit:TM1040_2811)

Predicted SEED Role

"putative chloramphenicol 3-O phosphotransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ERP6 at UniProt or InterPro

Protein Sequence (173 amino acids)

>PGA1_c33970 putative chloramphenicol phosphotransferase-like protein (Phaeobacter inhibens DSM 17395)
MALILFLHGASSSGKSTLATALRDQASRPFLHLSIDHLRDSGAWRPADYPDWHAARPAFF
AGFHRMIAGFAEAGNDLIIEHILDTPGWHAELQALLSHHDIVFIGLRPPLATLNQRERVR
GNRPAGSAALDAAHVHDGLRYDLEFDGSPPAADMARTLFTHLETPRLRSRFFA