Protein Info for PGA1_c33930 in Phaeobacter inhibens DSM 17395

Annotation: fumarylacetoacetate hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF01557: FAA_hydrolase" amino acids 28 to 225 (198 residues), 174.2 bits, see alignment E=1.6e-55

Best Hits

Swiss-Prot: 39% identical to FAHD1_ORYSJ: Probable acylpyruvase FAHD1, mitochondrial (FAHD1) from Oryza sativa subsp. japonica

KEGG orthology group: None (inferred from 68% identity to sil:SPO3691)

MetaCyc: 48% identical to 3-fumarylpyruvate hydrolase (Bradyrhizobium sp. JS329)
RXN-10445 [EC: 3.7.1.20]

Predicted SEED Role

"Fumarylacetoacetate hydrolase family protein" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F3N1 at UniProt or InterPro

Protein Sequence (229 amino acids)

>PGA1_c33930 fumarylacetoacetate hydrolase family protein (Phaeobacter inhibens DSM 17395)
MSKVLFDLPPVPAIPVEGRDESWPIGRIFCVGRNYAAHAAEMGVEVDREQPFYFTKSACH
AVLSGAEVPYPQGTENFHHEMELVVAISAPLQDATVAQARAAIWGYGCALDMTRRDLQLR
ERQKQRPWSLGKDLENGSVFAPLRAAEDWGAPGDQRIWLRVNDEIRQDASLAELIWSVED
ILCHLSLYYHLRPGDLVMTGTPAGVGPVVAGDDIEGGIDGLMPVRLALR