Protein Info for Psest_3400 in Pseudomonas stutzeri RCH2

Annotation: Copper resistance protein D.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details PF05425: CopD" amino acids 42 to 130 (89 residues), 39.8 bits, see alignment E=2.6e-14

Best Hits

KEGG orthology group: None (inferred from 88% identity to psa:PST_0944)

Predicted SEED Role

"Putative copper export protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GR76 at UniProt or InterPro

Protein Sequence (144 amino acids)

>Psest_3400 Copper resistance protein D. (Pseudomonas stutzeri RCH2)
MRHLLFLHLLGASVWVGGHLVLLFSVLPGALRRRDVQPVRQFEQLYERVGIPALLVQIVS
GLWLASLWLPHGQWFDSSPIAHLVQAKLVLLGFTALLGAHARLALIPKLDAQRLPQLGLH
IVLITLTAVAFVWVGSGFRFGGLF