Protein Info for Psest_3398 in Pseudomonas stutzeri RCH2

Annotation: large conductance mechanosensitive channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details PF01741: MscL" amino acids 3 to 131 (129 residues), 161.1 bits, see alignment E=7.7e-52 TIGR00220: large conductance mechanosensitive channel protein" amino acids 3 to 133 (131 residues), 175.2 bits, see alignment E=3.1e-56

Best Hits

Swiss-Prot: 79% identical to MSCL_PSE14: Large-conductance mechanosensitive channel (mscL) from Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 96% identity to psa:PST_0946)

MetaCyc: 67% identical to large conductance mechanosensitive channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMA5 at UniProt or InterPro

Protein Sequence (136 amino acids)

>Psest_3398 large conductance mechanosensitive channel protein (Pseudomonas stutzeri RCH2)
MSLISEFKAFAVRGNVVDMAVGIVIGAAFGKIVSSFVDGVIMPPLGLLIGGVDFSDLAIV
LKEAAGDAPAVLLRYGSFIQTVVDFLIIAFAIFMAIKAINHLKRKEAEAPSAPPAPSKEE
LLLTEIRDLLREQKSN