Protein Info for PGA1_c33870 in Phaeobacter inhibens DSM 17395

Annotation: putative HTH-type transcriptional regulator GntR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF00356: LacI" amino acids 10 to 55 (46 residues), 66.1 bits, see alignment 3.8e-22 PF00532: Peripla_BP_1" amino acids 69 to 315 (247 residues), 82.9 bits, see alignment E=5.7e-27 PF13407: Peripla_BP_4" amino acids 69 to 274 (206 residues), 50.8 bits, see alignment E=3.4e-17 PF13377: Peripla_BP_3" amino acids 178 to 337 (160 residues), 56.8 bits, see alignment E=6.3e-19

Best Hits

Swiss-Prot: 33% identical to GNTR_ECOLI: HTH-type transcriptional regulator GntR (gntR) from Escherichia coli (strain K12)

KEGG orthology group: K06145, LacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor (inferred from 90% identity to sit:TM1040_3128)

Predicted SEED Role

"Transcriptional regulator, LacI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E5A7 at UniProt or InterPro

Protein Sequence (341 amino acids)

>PGA1_c33870 putative HTH-type transcriptional regulator GntR (Phaeobacter inhibens DSM 17395)
MTTDNKRPLTLRDVSEATGVSEMTVSRVLRNRGDVSEKTRQKVLSAAKELGYVPNKIAGA
LASNRVNLVAVIIPSLSNMVFPEVLTGINSVLENTDLQPVVGVTDYQPEKEEKVLYEMLS
WRPSGVIIAGLEHTEAARAMLNASGIPVVEVMDTDGKPVDAMVGISHRRAGREMAKAILK
AGYRNIGFMGTKMPLDHRARKRFEGFTEALAKEGVEIMDRAFYSGGSALAKGREMTQEML
DRSPELDFLYYSNDMIGAGGMLYLMDQKIDIPGQIGLAGFNGVELLQGLPRQLATMDACR
LEIGRKAAEIIAAQLDNPDAEIEKHVTLTPTITFGDTLKRR