Protein Info for HP15_3270 in Marinobacter adhaerens HP15

Annotation: OmpA/MotB domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 PF12849: PBP_like_2" amino acids 60 to 270 (211 residues), 106.2 bits, see alignment E=2.7e-34 PF00691: OmpA" amino acids 320 to 401 (82 residues), 41 bits, see alignment E=2.2e-14

Best Hits

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 57% identity to hch:HCH_00115)

Predicted SEED Role

"Phosphate-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQX7 at UniProt or InterPro

Protein Sequence (419 amino acids)

>HP15_3270 OmpA/MotB domain protein (Marinobacter adhaerens HP15)
MAFQAQAYDLEIHGSNTVGATLAPMLVTGYLEEHGGGQVAARGTGVENEKILRAPVNNRA
AEVLVAAHGSSTGFKAMAAGKADIWASSRPVKPQEAEQFRARADLTAPESEHVIAIDGLA
ILVHPSNPVSKMSIETLGRVFSGQIRNWSELGGPDRPIHLYARDDRSGTWDTFKSLVLGK
QFELDSNARRYESNDQLSDDVSRDPSGIGFSGLASVRKSKLLAISEGNAPALHPNQLTVA
SEDYPLSRRLFMYTPGSDVPPLSAGLIGFALGQQGQALVAESGFISQNPIAVKPEFDEST
PESFRRLTSNYHRLTVNFRFSEGRTKLDNKARRDLQRVQQYLNQNGRSADDLLLIGFADT
QSHELRAQMISELRALSVRKALQEVNVPDVAYTGYGQYMPVGGSGSPRNGRVEVWIKSR