Protein Info for Psest_3378 in Pseudomonas stutzeri RCH2

Annotation: lipoprotein signal peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 68 to 86 (19 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 8 to 160 (153 residues), 134.8 bits, see alignment E=1.3e-43 PF01252: Peptidase_A8" amino acids 14 to 156 (143 residues), 154.2 bits, see alignment E=1.3e-49

Best Hits

Swiss-Prot: 80% identical to LSPA_PSEF5: Lipoprotein signal peptidase (lspA) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 93% identity to psa:PST_0965)

MetaCyc: 47% identical to lipoprotein signal peptidase (Escherichia coli K-12 substr. MG1655)
Signal peptidase II. [EC: 3.4.23.36]

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM80 at UniProt or InterPro

Protein Sequence (167 amino acids)

>Psest_3378 lipoprotein signal peptidase (Pseudomonas stutzeri RCH2)
MSARFGRLAWLWLSVLVIALDQATKHYFEANFSLYQKVDVIPGYFAWTLAYNTGAAFSFL
ADHSGWQRWLFAVIAIGVSAVLVVWLKRLKPSETWLAVALALVLGGAIGNLYDRVVLGHV
VDFILVHWQNRWYFPAFNIADSAITVGAVMLALDMFKSNKTGEAAHD